PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK34127.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 133aa    MW: 15609.4 Da    PI: 10.6872
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK34127.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.82.8e-0952107560
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                 k+ +r + N ++A++sR  K+++ie L++k keL+   + ++ + e+l++++++ k
  KFK34127.1  52 KKLKRIILNCVSAQKSRWMKRQYIEYLATKLKELQMGVSVMRIRCEMLNEMIQRFK 107
                 8899999*********************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.0E-744106No hitNo description
SuperFamilySSF579593.31E-752106No hitNo description
PfamPF001701.3E-752108IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MFRSSLPVPT SLKVSNGGNQ SGENKVGYFN YELEPGFIVR LRHDIDPNMD PKKLKRIILN  60
CVSAQKSRWM KRQYIEYLAT KLKELQMGVS VMRIRCEMLN EMIQRFKIER MKLEERVAAA  120
NQQFSSLKPR VKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013715349.14e-39PREDICTED: basic leucine zipper 19-like
RefseqXP_013715347.14e-39PREDICTED: basic leucine zipper 19-like
RefseqXP_009122367.14e-39PREDICTED: transcription factor RF2a isoform X1
TrEMBLA0A087GW753e-95A0A087GW75_ARAAL; Uncharacterized protein
STRINGBra009288.1-P3e-37(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144181821
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.16e-32bZIP family protein